Protein Info for BPHYT_RS17895 in Burkholderia phytofirmans PsJN

Annotation: secretin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 197 to 590 (394 residues), 411.4 bits, see alignment E=2.3e-127 PF21305: type_II_gspD_N0" amino acids 201 to 264 (64 residues), 29.4 bits, see alignment E=1.2e-10 PF03958: Secretin_N" amino acids 294 to 360 (67 residues), 44.3 bits, see alignment E=3.3e-15 PF00263: Secretin" amino acids 435 to 590 (156 residues), 158.3 bits, see alignment E=2.9e-50

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 100% identity to bpy:Bphyt_3599)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T706 at UniProt or InterPro

Protein Sequence (592 amino acids)

>BPHYT_RS17895 secretin (Burkholderia phytofirmans PsJN)
MMRLAKLFSIAVSSADTRVSPRLIVGLSLCFGAALGAGVTRASTPPLPPLPAYMPFDDAV
SPRDASYNGTPPLPRDVSAEEVPNPFRQDSADDRDASRMSSATAANTRTDEPAADDAEGL
LQLQSQSRRQSITPTREDPDADFDGSVPLRRQFAASARADATGTAALEGPPVPLPPLARL
SNAPRSAADAVLAPDDKPISLNFQRAELGAVLSAFARFTGLNIVASERVRGAVSLRLDKV
PWRTAFDTLLDVNGLAMERHGNVIWVAPIADLAARERQRFEAHARAADLEPLASRTFELH
YAHAEDVRRLLTGSGAQRVLSKRGAATADPRTNLLFVTDLEGRLAQIAALLASVDRPTRQ
VLIEARIVEGEHGFSRNLGVKLSMAATNADGTAKGLTDAGYDLSARPISGFDVATAGLTL
FAAGATRLLNIELSALEAQGRGEIVSSPRVVTADRMKAVVEQGTELPYQAKVGQGVSGVQ
FRRATLKLEVEPQIMPDGRVVLDLDVAKDSVGEQTDAGPAINTKHVQTRVEVEDGGTVSI
GGIYATDDRDDVTRVPVLGKIPVLGALFRHRAHRDQRSELAVFITPRVVQTN