Protein Info for BPHYT_RS17730 in Burkholderia phytofirmans PsJN

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 4 to 214 (211 residues), 126.3 bits, see alignment E=1.3e-40 PF12698: ABC2_membrane_3" amino acids 52 to 240 (189 residues), 45.7 bits, see alignment E=5e-16

Best Hits

Swiss-Prot: 37% identical to YADH_ECOLI: Inner membrane transport permease YadH (yadH) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to bpy:Bphyt_3564)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZ73 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BPHYT_RS17730 metal-dependent hydrolase (Burkholderia phytofirmans PsJN)
MSGFRTLFYKELLRFWKVAFQTVLAPVITALLYLTIFGHALRGHVEVYPGVEYTSFLIPG
LVMMSVLQNAFANSSSSLIQSKITGNLVFVLLPPLSHYEMFGAYVLAAVARGLAVGFGVF
IVTIWFVPVSFSAPLYIILFAIFGAAILGTLGLIAGIWADKFDQLAAFQNFLIMPLTFLS
GVFYSTHTLPPVWREVSRLNPFFYMIDGFRYGFFGMSDINPLASLAIVAGFFVVLAVVAM
RMLASGYKLRH