Protein Info for BPHYT_RS17640 in Burkholderia phytofirmans PsJN

Annotation: 2-alkenal reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details amino acids 24 to 27 (4 residues), see Phobius details transmembrane" amino acids 22 to 23 (2 residues), see Phobius details TIGR02037: peptidase Do" amino acids 63 to 386 (324 residues), 433.3 bits, see alignment E=5.3e-134 PF00089: Trypsin" amino acids 115 to 276 (162 residues), 73.2 bits, see alignment E=7.3e-24 PF13365: Trypsin_2" amino acids 117 to 251 (135 residues), 121.5 bits, see alignment E=1.3e-38 PF00595: PDZ" amino acids 288 to 368 (81 residues), 44.9 bits, see alignment E=3.2e-15 PF13180: PDZ_2" amino acids 292 to 380 (89 residues), 58.4 bits, see alignment E=1.8e-19 PF17820: PDZ_6" amino acids 316 to 356 (41 residues), 47 bits, see alignment 4.4e-16

Best Hits

KEGG orthology group: K08070, 2-alkenal reductase [EC: 1.3.1.74] (inferred from 100% identity to bpy:Bphyt_3546)

Predicted SEED Role

"Outer membrane stress sensor protease DegQ, serine protease" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZ51 at UniProt or InterPro

Protein Sequence (407 amino acids)

>BPHYT_RS17640 2-alkenal reductase (Burkholderia phytofirmans PsJN)
MLRRFWLFFAQAVTVLLALMFIIATLKPQWLQRQGQFGKQLAEPIVALREVAPGIGSGPA
QASYADAAQKAMPAVVNVFSSKDGSLPPDPRAKDPLFRYFFGDKNRKQQEQPASNLGSGV
IVSSEGYILTNQHVVDGADQIEIALADGRTTNAKVIGIDPETDLAVLKVNMTNLPTITLG
RMDQTRVGDVVLAIGNPFGVGQTVTMGIVSALGRNHLGINTFENFIQTDAAINPGNSGGA
LVDVNGNLLGINTAIYSRSGGSLGIGFAIPVSTARSVLESIITTGSVTRGWIGVEPQDVT
PEIAESFGLEQKSGAIVAGVLKNGPADRAGIKPGDILVSVNGQEITDTTRLLNVIAQIKP
GTAAKVHLVRKSREMDLDVTIGKRPPPPKQPAEDNGGGSGDQDDDGG