Protein Info for BPHYT_RS17625 in Burkholderia phytofirmans PsJN

Annotation: cytochrome B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 292 to 308 (17 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details PF00033: Cytochrome_B" amino acids 31 to 219 (189 residues), 226.6 bits, see alignment E=3.6e-71 PF13631: Cytochrom_B_N_2" amino acids 101 to 272 (172 residues), 148.5 bits, see alignment E=2.9e-47 PF00032: Cytochrom_B_C" amino acids 285 to 432 (148 residues), 110 bits, see alignment E=9.6e-36

Best Hits

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 100% identity to bpy:Bphyt_3543)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZ48 at UniProt or InterPro

Protein Sequence (459 amino acids)

>BPHYT_RS17625 cytochrome B (Burkholderia phytofirmans PsJN)
MAIEHEVETTGLVGWIDRRFPLTSTWKKHVSEYYAPKNFNFWYFFGSLALLVLVNQIVTG
IFLTMNYKPDATLAFSSVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLMYGSYR
KPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFIGPDLSLWIRG
DYVVSDVTLNRFFAFHVIAIPLVLIGLVVAHLVALHEVGSNNPDGIEIKAKKDPDGIPID
GIPFHPYYSVHDFMGVSVFLLIFAAIIFFAPEMGGYFLEANNFVPANPLQTPPEIAPVWY
FTAFYAMLRATTDPFKIVLMVIIGLLGLLALVRARGKWKLGLPVLAVLVILAMAFTESKF
WGVVVMGSAVVSLFFLPWLDRSPVKSIRYRPFFHKVFYGIFVLVFLTLAFLGTKPPSPTA
TLIAQVCALIYFAFFLGMPFWTRLGTFKQPPERVRFKPH