Protein Info for BPHYT_RS17520 in Burkholderia phytofirmans PsJN

Annotation: N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF17827: PrmC_N" amino acids 14 to 75 (62 residues), 55.9 bits, see alignment E=1.6e-18 TIGR00536: methyltransferase, HemK family" amino acids 21 to 280 (260 residues), 220.2 bits, see alignment E=2.9e-69 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 25 to 279 (255 residues), 286.8 bits, see alignment E=1.5e-89 PF03602: Cons_hypoth95" amino acids 94 to 198 (105 residues), 24.6 bits, see alignment E=5.3e-09 PF06325: PrmA" amino acids 104 to 192 (89 residues), 25.8 bits, see alignment E=2.1e-09 PF05175: MTS" amino acids 105 to 197 (93 residues), 53.3 bits, see alignment E=8.2e-18 PF13847: Methyltransf_31" amino acids 115 to 201 (87 residues), 41.8 bits, see alignment E=2.9e-14 PF13649: Methyltransf_25" amino acids 116 to 192 (77 residues), 34.8 bits, see alignment E=6.6e-12

Best Hits

Swiss-Prot: 68% identical to PRMC_BURPS: Release factor glutamine methyltransferase (prmC) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to bpy:Bphyt_3523)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZ28 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BPHYT_RS17520 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase (Burkholderia phytofirmans PsJN)
MTSATPATSATPAALLRASPLPPLEARILLTHVLGWRPTQLITRSDEALDGKLVERYQTL
EARRVAGEPVAQLVGAREFFGLDFEVTPHVLIPRPETELLVDTALSALENLVRPRVLDLG
TGTGAIAVAIASMRPDARVWALDRSAEALAVATRNAARLLDAQRPGGAVVLTQSDWYDSL
DAALRFDVIVSNPPYIASGDPHLYEGDLRFEPRGALTDEADGLSAIRAIIAGAPTRLAAD
GVLWIEHGYDQAEAVRALLTAQGFAQVRSERDLAGIERISGGRLGG