Protein Info for BPHYT_RS17375 in Burkholderia phytofirmans PsJN

Annotation: magnesium transporter ApaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF04379: DUF525" amino acids 17 to 101 (85 residues), 120.7 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 73% identical to APAG_RALSO: Protein ApaG (apaG) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06195, ApaG protein (inferred from 98% identity to bxe:Bxe_A0464)

Predicted SEED Role

"ApaG protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYZ8 at UniProt or InterPro

Protein Sequence (124 amino acids)

>BPHYT_RS17375 magnesium transporter ApaG (Burkholderia phytofirmans PsJN)
MSQYEFSVSAQVQYLPEESDPERRQYAFAYTLTIRNTGQVPAQLIARHWVITDSDKSVQE
VKGLGVVGHQPLLKPGEHFEYTSWAVIATPVGTMRGEYFCVAEDGERFDAPVPEFILRMP
RTLH