Protein Info for BPHYT_RS17230 in Burkholderia phytofirmans PsJN

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 7 to 457 (451 residues), 553.8 bits, E=1.8e-170
• PF01225: Mur_ligase
  • amino acids 7 to 105 (99 residues), 110.3 bits, E=7.1e-36
• PF08245: Mur_ligase_M
  • amino acids 110 to 290 (181 residues), 94 bits, E=1.9e-30
• PF02875: Mur_ligase_C
  • amino acids 311 to 403 (93 residues), 53.9 bits, E=2.7e-18

Best Hits

Swiss-Prot: 100% identical to MURC_PARPJ: UDP-N-acetylmuramate--L-alanine ligase (murC) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to bpy:Bphyt_3469)

MetaCyc: 54% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See B2SYX4 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BPHYT_RS17230 UDP-N-acetylmuramate--L-alanine ligase (Burkholderia phytofirmans PsJN)
MKHIVKHIHFVGIGGVGMSGIAEVLVNLGYQVSGSDLTSNAITDRLAALGARIAIGHAAE
NIEGANAVVVSTAVRSDNPEVLAARHRRIPIVPRAVMLAELMRLKQGIAIAGTHGKTTTT
SLVASVLAAGGLDPTFVIGGRLISAGANARLGTGDFIVAEADESDASFLNLFPVIEVITN
IDADHMDTYGHDFARLKQAFIEFTHRLPFYGIAVLCVDDPNVKEILPFVSKPIIRYGFAP
DAQVRAVNVKAHDGKMHFTAMREDAAPIDIVLNLPGEHNVQNALAAIAIATELEVKDADI
QRALADFNGVGRRFQRYGEVPVVSEGKASGAYTLVDDYGHHPVEMAATVAAARGAFPGRR
LVLAFQPHRFTRTRDCFEDFVKVLSTVDALVLTEVYSAGESPIVAADGRALARALRVAGK
VEPVFVDTVDEVPDALSAVVRDGDVVITMGAGSIGGVPGRLAQETKV