Protein Info for BPHYT_RS17225 in Burkholderia phytofirmans PsJN

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01205: D-alanine--D-alanine ligase" amino acids 11 to 309 (299 residues), 313.8 bits, see alignment E=5.4e-98 PF01820: Dala_Dala_lig_N" amino acids 65 to 93 (29 residues), 35.2 bits, see alignment (E = 1.6e-12) PF07478: Dala_Dala_lig_C" amino acids 110 to 306 (197 residues), 195 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 100% identical to DDL_PARPJ: D-alanine--D-alanine ligase (ddl) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to bpy:Bphyt_3468)

MetaCyc: 52% identical to D-alanine--D-alanine ligase B (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYX3 at UniProt or InterPro

Protein Sequence (313 amino acids)

>BPHYT_RS17225 D-alanine--D-alanine ligase (Burkholderia phytofirmans PsJN)
MSSIDPKQFGKVAVLLGGNSAEREVSLNSGRLVLQGLRDAGVDAHPFDPAERPLAALKEE
GFVRAFNALHGGYGENGQIQGALDFYGIKYTGSGVLGSALGLDKFRTKLVWQQLGIPTPP
FEAVLRGDDYEARSKEIVAKLGLPLFVKPASEGSSVAVIKVKSADALPAALIEAVKYDKI
VVVEKSVEGGGEYTACIAGNLDLPVIRIVPAGEFYDYHAKYIANDTQYLIPCGLAADEEA
RLKVLARRAFDVLGCTDWGRADFMLDADGNPYFLEVNTAPGMTDHSLPPKAARAVGISYQ
ELVVGVLALTLQD