Protein Info for BPHYT_RS17160 in Burkholderia phytofirmans PsJN

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 3 to 178 (176 residues), 208 bits, E=4.8e-66
• TIGR00152: dephospho-CoA kinase
  • amino acids 4 to 187 (184 residues), 170.9 bits, E=1.4e-54

Best Hits

Swiss-Prot: 74% identical to COAE_BURL3: Dephospho-CoA kinase (coaE) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 100% identity to bpy:Bphyt_3455)

MetaCyc: 50% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See B2SYW0 at UniProt or InterPro

Protein Sequence (200 amino acids)

>BPHYT_RS17160 dephospho-CoA kinase (Burkholderia phytofirmans PsJN)
MFAVGLTGGIGSGKSTVADLFAAHGVPLVDTDLIAHRITAPHGIAMPPIAAEFGEAFVAP
DGSLDRARMRALVFSDDSARKRLEGITHPLIRAETEREQREAQGPYVIVVVPLLVESGTW
KTRVNRVLTVDCSVETQISRVMSRNNFSREQVLAIIARQATREARLAAADDVIDNDNAPL
DALTAQVDTLHRVYLSLAGA