Protein Info for BPHYT_RS17020 in Burkholderia phytofirmans PsJN

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 3 to 296 (294 residues), 327.6 bits, E=3.4e-101
• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 4 to 290 (287 residues), 239.3 bits, E=3.1e-75
• PF05175: MTS
  • amino acids 151 to 234 (84 residues), 41 bits, E=6.2e-14
• PF01135: PCMT
  • amino acids 153 to 214 (62 residues), 24.3 bits, E=9.7e-09
• PF02475: Met_10
  • amino acids 160 to 214 (55 residues), 22.5 bits, E=3.4e-08
• PF13489: Methyltransf_23
  • amino acids 164 to 285 (122 residues), 44.8 bits, E=4.5e-15
• PF13847: Methyltransf_31
  • amino acids 167 to 261 (95 residues), 39.2 bits, E=2.5e-13
• PF13649: Methyltransf_25
  • amino acids 169 to 255 (87 residues), 39.6 bits, E=2.8e-13
• PF08241: Methyltransf_11
  • amino acids 170 to 257 (88 residues), 33.5 bits, E=2.1e-11

Best Hits

Swiss-Prot: 100% identical to PRMA_PARPJ: Ribosomal protein L11 methyltransferase (prmA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to bpy:Bphyt_3428)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See B2SYT3 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BPHYT_RS17020 ribosomal protein L11 methyltransferase (Burkholderia phytofirmans PsJN)
MSYRELIAELAREHAEEFSDALLELGALSVSVEDADADTPDEQPLFGEPGLTPDRTAWQR
SRVIALLAPEHEPAVLLTAAANEIGLPAAPSFTVREVEDQDWVRLTQSQFDPIKIGERIW
VVPSWHDAPDPEALVLELDPGLAFGTGSHPTTRLCMEWLEQSVQPEQSVLDYGCGSGILA
ILAKKCGANPVYGIDIDPQAVESARHNSERNRAEVIYGLPDECPTGEFDIVVANILSNPL
KLMASMLTSKVKPGGKIALSGILARQADEVAQVYSRWIDISVWREHEGWVCLSGTRRESH