Protein Info for BPHYT_RS16915 in Burkholderia phytofirmans PsJN

Updated annotation (from data): L-arabinono-1,4-lactonase; galactonolactonase
Rationale: specifically important for utilization of L-arabinose and D-galactose; it is not certain whether the galactose dehydrogenase (BPHYT_RS16920) forms the 1,5-lactone or the 1,4-lactone.
Original annotation: gluconolaconase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to ARALA_AZOBR: L-arabinolactonase (araB) from Azospirillum brasilense

KEGG orthology group: K13874, L-arabinonolactonase [EC: 3.1.1.15] (inferred from 100% identity to bpy:Bphyt_3407)

Predicted SEED Role

"L-arabinolactonase (EC 3.1.1.15)" in subsystem L-Arabinose utilization (EC 3.1.1.15)

MetaCyc Pathways

L-arabinose degradation III (5/6 steps found)
L-arabinose degradation V (5/6 steps found)
L-arabinose degradation IV (6/8 steps found)
superpathway of pentose and pentitol degradation (22/42 steps found)

KEGG Metabolic Maps

Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYR2 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BPHYT_RS16915 L-arabinono-1,4-lactonase; galactonolactonase (Burkholderia phytofirmans PsJN)
MSASGSPGTAALLLDTKCTLGEGATWCAQTGHFYWTDIEGARLWRYDPRDCSNMSWHMPE
RLATFALCADPRYLLLGLATHLAFFELATGETRRIIDVEAGLNTRVNDGRCDRQGRFVFG
TKDEGAPLQAIGGFYRLGHDLSLERLPLPAPAISNSIAFSPDGATMYYCDSPTREIRACD
YRADGSIANDRLFTRLTDATGEPDGSTVDRDGGLWNAQWGGRRVVRYGPDGMETERVDVP
TAQPSCVALGGTQLDTLYITSARCDLDAAALANDPHAGGVFIATLGRRGLPEPVFQGAPA