Protein Info for BPHYT_RS16765 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details PF03653: UPF0093" amino acids 2 to 138 (137 residues), 140.6 bits, see alignment E=2.3e-45

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 100% identity to bpy:Bphyt_3376)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYN2 at UniProt or InterPro

Protein Sequence (138 amino acids)

>BPHYT_RS16765 membrane protein (Burkholderia phytofirmans PsJN)
MLWVKTFHIVLIASWFAGLFYLPRIFVNLAMETEPAATARLLTMARKLFRFMTFIAVPAL
ACGLWLWLVIGIGRGQGWIHAKVGVVVLLLIYHAYCGVLLRTFERGENRRSDKWYRMFNE
LPVLGMLAAVALVVIKPF