Protein Info for BPHYT_RS16720 in Burkholderia phytofirmans PsJN
Updated annotation (from data): Gluconokinase (EC 2.7.1.12)
Rationale: Specifically important for utilizing D-Gluconic Acid sodium salt. Automated validation from mutant phenotype: the predicted function (GLUCONOKIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: gluconate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to GNTK_ECOLI: Thermoresistant gluconokinase (gntK) from Escherichia coli (strain K12)
KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 100% identity to bpy:Bphyt_3367)MetaCyc: 44% identical to D-gluconate kinase, thermostable (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]
Predicted SEED Role
"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)
MetaCyc Pathways
- L-idonate degradation (3/3 steps found)
- D-gluconate degradation (1/1 steps found)
- ketogluconate metabolism (6/8 steps found)
- sorbitol biosynthesis II (2/3 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2SYM3 at UniProt or InterPro
Protein Sequence (165 amino acids)
>BPHYT_RS16720 Gluconokinase (EC 2.7.1.12) (Burkholderia phytofirmans PsJN) MILIAMGVSGAGKTRIGEMLAERLHCAFTDGDAFHSAANKEKMHHGIPLTDEDRWPWLQT IRVAIVEKQKAGETAVFTCSSLKRSYRDVLRDGDKDVCFVYLKGSREVLEQRLTTRTGHF FDPSLLQSQLDTLEEPGPDEAITVSIELSPEEIVVEVLKQVEARK