Protein Info for BPHYT_RS16645 in Burkholderia phytofirmans PsJN

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF03702: AnmK" amino acids 9 to 375 (367 residues), 440.3 bits, see alignment E=3.1e-136

Best Hits

Swiss-Prot: 97% identical to ANMK_PARXL: Anhydro-N-acetylmuramic acid kinase (anmK) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to bpy:Bphyt_3351)

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYK7 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BPHYT_RS16645 anhydro-N-acetylmuramic acid kinase (Burkholderia phytofirmans PsJN)
MAQDPADGVYFGLMSGTSMDGVDGVAVKFAQGKPPVVLAEAFVGFAAGLRDALFALQQPG
DNEIEREALAANALATRYAVCCHELLHGSRVPAAEVRAIGVHGQTVRHRPEKGYTRQINN
PALLAEMMHIDVIADFRSRDVAAGGQGAPLVPAFHATVFGAKNETRVVCNLGGISNITIL
NATGSVRGFDCGPANALLDEWAQRHLGKPFDENGHFAAGGKVDRTLLNALLDEPFFSQQP
PKSTGRDLFNAEWLDAKLQPFAGLDPADAQATLVALTAVTVAREIERHASDARAVYVCGG
GARNPEILKALQQALEDSGVSGVPVMTTDALGVPPSQVEPLAFAWLAMRCVARLPGNLPA
VTGASAERVLGAIYPR