Protein Info for BPHYT_RS16640 in Burkholderia phytofirmans PsJN

Annotation: tyrosyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR00234: tyrosine--tRNA ligase" amino acids 23 to 413 (391 residues), 385.4 bits, see alignment E=1.7e-119 PF00579: tRNA-synt_1b" amino acids 52 to 334 (283 residues), 261.3 bits, see alignment E=1.8e-81 PF13275: S4_2" amino acids 348 to 402 (55 residues), 27.3 bits, see alignment 4.1e-10 PF01479: S4" amino acids 359 to 399 (41 residues), 26.5 bits, see alignment 6.6e-10

Best Hits

Swiss-Prot: 94% identical to SYY_BURL3: Tyrosine--tRNA ligase (tyrS) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to bpy:Bphyt_3350)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYK6 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BPHYT_RS16640 tyrosyl-tRNA synthetase (Burkholderia phytofirmans PsJN)
MSTESTKPNPAAAFPITDEVRHALAITKRGVDELLIEDEFAQKLAKSAATGKPLRIKLGL
DPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTREQIESN
AKTYFDQAALVLDREKTEIRYNSEWSMPLGADGMIKLASRYTVARILEREDFTKRFQGGV
PISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQYGQEQQCILTMPLLEG
LDGVEKMSKSKNNYIGISEKPTDMFGKLMSISDVLMWRYFELLSFRPMDEIAGFRKEIEA
GRNPRDFKVLLGQEIVARFHSQADAERALEDFNHRAKGGVPDDIPAVTLAGAPLAIGQLL
KQANLVPSTSEALRNIEQGGVKIDGATVSDKGLKVEAGEYVVQVGKRRFARVTLTA