Protein Info for BPHYT_RS16620 in Burkholderia phytofirmans PsJN

Annotation: holliday junction ATP-dependent DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF05496: RuvB_N" amino acids 29 to 187 (159 residues), 277.6 bits, see alignment E=1.1e-86 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 33 to 335 (303 residues), 488.8 bits, see alignment E=2.6e-151 PF07728: AAA_5" amino acids 63 to 181 (119 residues), 31.5 bits, see alignment E=6.5e-11 PF00004: AAA" amino acids 64 to 186 (123 residues), 76.7 bits, see alignment E=9.9e-25 PF17864: AAA_lid_4" amino acids 190 to 263 (74 residues), 114.8 bits, see alignment E=5e-37 PF05491: RuvB_C" amino acids 265 to 334 (70 residues), 79.1 bits, see alignment E=7.6e-26

Best Hits

Swiss-Prot: 100% identical to RUVB_PARPJ: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 100% identity to bpy:Bphyt_3346)

MetaCyc: 72% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYK2 at UniProt or InterPro

Protein Sequence (354 amino acids)

>BPHYT_RS16620 holliday junction ATP-dependent DNA helicase RuvB (Burkholderia phytofirmans PsJN)
MIETDKLAAERIIAATPVSPNEEAFERALRPRQLEEYVGQEKVRGQLEIFIEAAKRRSES
LDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLERAGDLAALLTNLEANDVLFIDE
IHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFTLVGATTRAGMLTNPLRDR
FGIVARLEFYNAEELARIVTRSASLLNAQIHPDGAFEIAKRARGTPRIANRLLRRVRDFA
EVKADGNITAQVADAALKMLDVDAVGFDLMDRKLLEAILHKFDGGPVGVDNLAAAIGEER
DTIEDVLEPYLIQQGFLQRTPRGRVATLLTYRHFGLAAPDSSSGLPGLWDSAAT