Protein Info for BPHYT_RS16555 in Burkholderia phytofirmans PsJN

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00571: CBS" amino acids 89 to 128 (40 residues), 18.9 bits, see alignment 1.6e-07 amino acids 134 to 188 (55 residues), 28.7 bits, see alignment E=1.3e-10 PF03471: CorC_HlyC" amino acids 208 to 281 (74 residues), 68 bits, see alignment E=5.7e-23

Best Hits

Swiss-Prot: 48% identical to CORC_PASMU: Magnesium and cobalt efflux protein CorC (corC) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 100% identity to bpy:Bphyt_3333)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYI9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>BPHYT_RS16555 cation transporter (Burkholderia phytofirmans PsJN)
MNDTYPSRRQLDKPQEKRSLLERLTDFISPEPDSRAELLEILQDAHERNLIDADSLSMIE
GVFQVSELSARDIMVPRAQMDAINIADNPAEFIPYVLEKAHSRYPVYEGNRDNIIGVLLA
KDLLRYYAEEEFDVRGMLRPAVFIPESKRLNVLLHDFRVNRNHLAVVVDEYGGVAGLITI
EDVLEQIVGDIEDEYDFDEESGNIIASPDGRFRVRALTEIEQFNEAFGTHYSDDEVDTIG
GLVTHHFGRVPHRGEKVRLDDLIFEILRGDARQIHMLLVRRDPLAGQREREAQHVQT