Protein Info for BPHYT_RS16510 in Burkholderia phytofirmans PsJN

Annotation: 3,4-Dihydroxy-2-butanone 4-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 31 to 225 (195 residues), 231.7 bits, see alignment E=3.1e-73 PF00926: DHBP_synthase" amino acids 34 to 223 (190 residues), 262.7 bits, see alignment E=8.2e-83

Best Hits

Swiss-Prot: 69% identical to RIBB_SHESR: 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02858, 3,4-dihydroxy 2-butanone 4-phosphate synthase [EC: 4.1.99.12] (inferred from 100% identity to bpy:Bphyt_3324)

MetaCyc: 61% identical to 3,4-dihydroxy-2-butanone-4-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3,4-dihydroxy-2-butanone-4-phosphate synthase. [EC: 4.1.99.12]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12)" (EC 4.1.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.12

Use Curated BLAST to search for 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYI0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>BPHYT_RS16510 3,4-Dihydroxy-2-butanone 4-phosphate synthase (Burkholderia phytofirmans PsJN)
MTFATFPAPSTIADSAFLDLPLLDTEAVPPRIAAALQAMRDGRAVVLQDDHDRENEADLI
VSAERLSVETMALLIRECSGIVCLCLPDEKIRALELPPMAVNNESRHGTAFTISIEARDG
VTTGVSALDRVTTIRAAIADTAKPADIVRPGHVFPLRAQPGGVLARRGHTEGTVDLAILA
GLKPAGVLCELMNPDGTMTRGADVERFAAQHNLPMLTIAELVEFRQTLAQARECVADEA