Protein Info for BPHYT_RS16120 in Burkholderia phytofirmans PsJN

Updated annotation (from data): sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14)
Rationale: Specifically important for: D-Sorbitol. The KEGG EC number implies that sorbose would be the product, but it is not clear how sorbose would be consumed. The only other genes with specific phenotypes on sorbitol are an ABC transporter, the fructokinase BPHYT_RS02045, and an apparent polar effect on mannose isomerase BPHYT_RS02050. Also this protein is 60% similar to DHSO_RHOSH (polS), which is annotated in UniProt as forming sorbose but is believed to form D-fructose, see PMID: 15805591 (SEED_correct)
Original annotation: sorbitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 197 (190 residues), 187.8 bits, see alignment E=2.3e-59 PF08659: KR" amino acids 11 to 162 (152 residues), 50.8 bits, see alignment E=2.9e-17 PF13561: adh_short_C2" amino acids 14 to 256 (243 residues), 198.2 bits, see alignment E=2.5e-62

Best Hits

Swiss-Prot: 64% identical to SDH_RHOSH: Sorbitol dehydrogenase (polS) from Rhodobacter sphaeroides

KEGG orthology group: K08261, D-sorbitol dehydrogenase (acceptor) [EC: 1.1.99.21] (inferred from 100% identity to bpy:Bphyt_3247)

MetaCyc: 58% identical to galactitol 2-dehydrogenase (Agrobacterium fabrum C58)
Galactitol 2-dehydrogenase. [EC: 1.1.1.16]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.14

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.16 or 1.1.99.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SYA3 at UniProt or InterPro

Protein Sequence (260 amino acids)

>BPHYT_RS16120 sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (Burkholderia phytofirmans PsJN)
MAARLQDKVAILTGAASGIGEAVARRYLDEGARCVLVDVKPADSFGDSLRATYGDRVLTV
SADVTRRDDIQRIVASTLERFGQIDILFNNAALFDMRPILEESWDVFDRLFAVNVKGMFF
LMQAVAQKMVEQGCGGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAPHKIN
VNGIAPGVVDTPMWNEVDALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLTGAALFLAS
ADADYITAQTLNVDGGNWMS