Protein Info for BPHYT_RS15985 in Burkholderia phytofirmans PsJN

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00085: Thioredoxin" amino acids 4 to 102 (99 residues), 91.3 bits, see alignment E=1.1e-29 TIGR01068: thioredoxin" amino acids 14 to 103 (90 residues), 108.9 bits, see alignment E=6.3e-36 PF13098: Thioredoxin_2" amino acids 19 to 99 (81 residues), 32.4 bits, see alignment E=3.1e-11 PF13905: Thioredoxin_8" amino acids 20 to 71 (52 residues), 29.1 bits, see alignment 3.2e-10 PF13432: TPR_16" amino acids 115 to 166 (52 residues), 27.3 bits, see alignment 1.3e-09 amino acids 202 to 244 (43 residues), 18.9 bits, see alignment 5.5e-07 PF14559: TPR_19" amino acids 119 to 188 (70 residues), 40.8 bits, see alignment E=6.9e-14 PF14561: TPR_20" amino acids 194 to 282 (89 residues), 95.5 bits, see alignment E=5.7e-31

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to bpy:Bphyt_3219)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY76 at UniProt or InterPro

Protein Sequence (282 amino acids)

>BPHYT_RS15985 thioredoxin (Burkholderia phytofirmans PsJN)
MDTTLATFEQDVITASTLAPVLVDFWAPWCGPCKTLGPMLEKLEAEAAGKWKLVKVNVDE
NQELAAHFQVRSIPHVMAFADGRPVDQFVGVLPEGQLREFIERLVPQGADAARLEAQAAL
AEGRREDAYDALQAALAYDPGFDEARMDRIEMLLEDNRLDEARNEVDLLSPKTTQGIDAR
FNAIKTRLDAVDAAADLPPTDALEAKVAADPDDLEARFDLASAFIARRKYAEALEHLLAI
VQRDRTFRDDIGRKTMLSVFDLAAHQPELVSQWRRKLSASLF