Protein Info for BPHYT_RS15900 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 51 to 69 (19 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 408 to 408 (1 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 445 to 468 (24 residues), see Phobius details amino acids 483 to 506 (24 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 3 to 510 (508 residues), 461.4 bits, see alignment E=2e-142 PF03023: MurJ" amino acids 28 to 472 (445 residues), 444.3 bits, see alignment E=4.4e-137

Best Hits

Swiss-Prot: 84% identical to MURJ_BURCJ: Lipid II flippase MurJ (murJ) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K03980, virulence factor (inferred from 100% identity to bpy:Bphyt_3202)

MetaCyc: 55% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY59 at UniProt or InterPro

Protein Sequence (516 amino acids)

>BPHYT_RS15900 membrane protein (Burkholderia phytofirmans PsJN)
MNLFRALLTVSGFTLLSRVTGLARETLIARAFGASQYTDAFYVAFRIPNLLRRISAEGAF
SQAFVPILAEFKNSQGHDATKALVDATSTVLAWALAILSLIGVVGASGVVFIVASGLAHE
GQAYALAVTMTRIMFPYIIFISLTSLASGVLNTYKNFSLPAFAPVLLNVAFIVAAVFVAP
RLQTPVYSLAWAVIAGGVLQFLVQLPGLKKIDMIPRIGLNPVKALAHRGVKRVLSKMVPA
MFAVSVAQISLIINTNIASRIGPGAVSWINYADRLMEFPTALLGVALGTILLPSLSKAHV
DADPHEYSSLLDWGLRVTFLLAAPSAVALFFFAQPLTATLFHYGKFDGNSVVMVARALSA
YGVGLIGLILIKILAPGFYAKQDIKTPVKIGVGVLILTQLSNYLFVPIFAHAGLTLSVGL
GACGNALLLFLGLRKRGIYTPSSGWLKFFVQLFGACLVLAGTMHWLAISFDWIGMHSRPV
DRMVLLAACLVLFAALYFGMLWLMGFKYAYFKRRVK