Protein Info for BPHYT_RS15840 in Burkholderia phytofirmans PsJN

Annotation: Clp protease proteolytic subunit ClpP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00493: ATP-dependent Clp endopeptidase, proteolytic subunit ClpP" amino acids 12 to 201 (190 residues), 322.3 bits, see alignment E=5.1e-101 PF00574: CLP_protease" amino acids 23 to 202 (180 residues), 281.6 bits, see alignment E=1.5e-88

Best Hits

Swiss-Prot: 94% identical to CLPP1_PARXL: ATP-dependent Clp protease proteolytic subunit 1 (clpP1) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 100% identity to bpy:Bphyt_3190)

MetaCyc: 63% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6L8 at UniProt or InterPro

Protein Sequence (215 amino acids)

>BPHYT_RS15840 Clp protease proteolytic subunit ClpP (Burkholderia phytofirmans PsJN)
MHSNYPNITGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLF
LESENPDKDICFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLTAGQRG
KRYALPNARIMIHQPSGGSQGTAADVEIQAKEVLYLRERLNAMMAERTGRSIEAIARDTD
RDNFMSAQSAKTYGLVDEVLETRAALNVAPYHMDK