Protein Info for BPHYT_RS15715 in Burkholderia phytofirmans PsJN

Annotation: ATP-dependent Clp protease adapter protein ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF02617: ClpS" amino acids 21 to 99 (79 residues), 124.1 bits, see alignment E=7.5e-41

Best Hits

Swiss-Prot: 100% identical to CLPS_PARPJ: ATP-dependent Clp protease adapter protein ClpS (clpS) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 98% identity to bge:BC1002_2407)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6J4 at UniProt or InterPro

Protein Sequence (104 amino acids)

>BPHYT_RS15715 ATP-dependent Clp protease adapter protein ClpS (Burkholderia phytofirmans PsJN)
MAIIPDKQDGTVLERQEKKLKPPSMYKVVLLNDDFTPMEFVVMVVQEYFNKDRETATQVM
LKVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEEA