Protein Info for BPHYT_RS15660 in Burkholderia phytofirmans PsJN

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 251 to 316 (66 residues), 64.3 bits, see alignment E=8.9e-22 PF21082: MS_channel_3rd" amino acids 326 to 408 (83 residues), 50.4 bits, see alignment E=2.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3155)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6I3 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BPHYT_RS15660 mechanosensitive ion channel protein MscS (Burkholderia phytofirmans PsJN)
MFSDLTRDFGQPVMLWQVGVLVATLAIAWLLARVLRRALDLRRQTRYQTLRFGAESLNRA
FFPLVGAVLVWLARSITGQFMHTALLDLALVPLFGIGLIYIVFFLARRVFSHDGETHPLL
FLVEKIVSLVVWVGMVLTVMGIQDDVIAWMAGVHFSVANAHLTLLSLISGLLWVCVTMIV
AMWLGSTFEDRLMRSKTLDANLKVVVARVGRAAFVLAAVLISLSLVGIDITVLGVFGGAL
GVGLGFGLQKIASNYVSGFIILIDRSLRIGDTISVGGLQGMVTQIRTRYTVVRGLDGIET
LIPNEKLITDVVQNQSSYLTRGHAKAAVQVAYTSDVEQAMTLLAEAAQGVPRVLQEPAPT
AYLAGFGADGINLELGFWIEDAATGTSGVRSAVNRNIWRLFSEHDITIPFAQREVRIVGN
VSEVMPQPVTMTASAVKPSDSAR