Protein Info for BPHYT_RS15650 in Burkholderia phytofirmans PsJN

Annotation: quinolinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 42 to 352 (311 residues), 355.6 bits, see alignment E=1.2e-110 PF02445: NadA" amino acids 45 to 351 (307 residues), 347.6 bits, see alignment E=2.6e-108

Best Hits

Swiss-Prot: 92% identical to NADA_BURA4: Quinolinate synthase A (nadA) from Burkholderia ambifaria (strain MC40-6)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to bpy:Bphyt_3153)

MetaCyc: 65% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6I1 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BPHYT_RS15650 quinolinate synthetase (Burkholderia phytofirmans PsJN)
MDQQAIRTVEYDRPQAQGTTCGIGQAWAKVPDMPSAEEKVALKARIRALLEREKAVLVAH
YYVDAELQELADETGGCVADSLEMARFGRDHAAQTLVVAGVRFMGETAKILSPDKRILMP
DLDATCSLDLGCPVDEFSAFCDAHPDRTVVVYANTSAAVKARADWMVTSSIGLEIVADLH
ARGEKIIWAPDRHLGSYIQNKTGADMLLWQGSCLVHDEFKGIELDLLRAEYPGAKVLVHP
ESPANVVAQADVVGSTTQLIDAAQKLDATHFIVATDLGILHKMQLAAPGKTLIAAPTAGN
SATCKSCAHCPWMAMNGLANLADVLERGHNEIFVDRAIGERARLPIDRMLDFAARHKKRV
QASGDLARDTQLYSNVGAA