Protein Info for BPHYT_RS15625 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF20582: UPF0758_N" amino acids 40 to 114 (75 residues), 69.1 bits, see alignment E=2.7e-23 TIGR00608: DNA repair protein RadC" amino acids 46 to 258 (213 residues), 221.3 bits, see alignment E=6.2e-70 PF04002: RadC" amino acids 138 to 257 (120 residues), 135.7 bits, see alignment E=7.9e-44

Best Hits

Swiss-Prot: 100% identical to Y3148_PARPJ: UPF0758 protein Bphyt_3148 (Bphyt_3148) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to bpy:Bphyt_3148)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6H6 at UniProt or InterPro

Protein Sequence (259 amino acids)

>BPHYT_RS15625 hypothetical protein (Burkholderia phytofirmans PsJN)
MAEDATLVDETALEAAAGESPPSNATACGELAPSPLLRGKWLKDDMPRERLLRQGPGVLS
DTEMIVLILGSGLPGHDVFSVARELLDRFGSLRAMLDATYTDFDGLRGIGPAKKAQLLAI
MEMARRSLVDKLRSRSLLNSPEAVENYLRLRIGGRPLEVFVSLFLDARHRLIHCEESAQG
TLTRMAVYPREIVRRALSLNAASLIVAHNHPSGAVQPSASDCRLTHTLRDALTLIDVQLV
DHLVVGVDSVYSFARAGWP