Protein Info for BPHYT_RS15575 in Burkholderia phytofirmans PsJN

Annotation: CDP-6-deoxy-delta-3,4-glucoseen reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF00111: Fer2" amino acids 6 to 81 (76 residues), 60.5 bits, see alignment E=1.9e-20 PF00970: FAD_binding_6" amino acids 105 to 197 (93 residues), 60.5 bits, see alignment E=2.6e-20 PF00175: NAD_binding_1" amino acids 209 to 314 (106 residues), 79.3 bits, see alignment E=5.3e-26

Best Hits

Swiss-Prot: 44% identical to ASCD_YERPS: CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase (ascD) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 98% identity to bxe:Bxe_A0829)

MetaCyc: 44% identical to CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase (Yersinia pseudotuberculosis)
CDP-4-dehydro-6-deoxyglucose reductase. [EC: 1.17.1.1]

Predicted SEED Role

"CDP-6-deoxy-delta-3,4-glucoseen reductase-like"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6G6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>BPHYT_RS15575 CDP-6-deoxy-delta-3,4-glucoseen reductase (Burkholderia phytofirmans PsJN)
MAFNVTLRQSGRQFQVEQDEPVLSAALRQGIGLPYGCKNGACGSCKGTVVSGEIEQRAHS
SSALSNDEKTRGMALFCCATACTDLEVDIREVAGVGDVQVKKLPCRVNAIERKADDVVVL
KLQLPANERLQYLAGQYLEFILKDGKRRSYSMANAPHTEGPIELHIRHMPGGAFTDHVFN
TMKERDILRFEAPLGTFFLREDSDKPIVLLASGTGFAPLKAIVEHAVFKNLNRPMTLYWG
ARRKKDLYLLELAEQWAREIPNFKFLPVLSEPDAGDAWTGRVGFVHRAVIEDLPDLSAYQ
VYACGAPVMVESAQRDFTQHHGLPEDEFYADSFTSAADLANAV