Protein Info for BPHYT_RS15225 in Burkholderia phytofirmans PsJN

Annotation: fructose-1,6-bisphosphatase class 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 8 to 195 (188 residues), 209.9 bits, E=2.8e-66
• PF18913: FBPase_C
  • amino acids 200 to 333 (134 residues), 169 bits, E=4.2e-54

Best Hits

Swiss-Prot: 100% identical to F16PA_PARPJ: Fructose-1,6-bisphosphatase class 1 (fbp) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to bpy:Bphyt_3071)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• gluconeogenesis III (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See B2T699 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BPHYT_RS15225 fructose-1,6-bisphosphatase class 1 (Burkholderia phytofirmans PsJN)
MALQRRTTLTKYLIEQQRETNNLPADLRLLIEVVARACKAISYHVSKGALGDALGTAGSE
NVQGEVQKKLDILSNEILLEANEWGGNLAGMASEEMEQFFPIPANYPKGEYLLVFDPLDG
SSNIDVNVSIGTIFSVLRCPDGQQPTEQSFLQPGTQQVAAGYAVYGPQTVLVLTTGNGVN
CFTLDRELGSWVLTQSDMRIPVETREYAINASNERHWYPPVEQYIGELKAGKDGPRQSDF
NMRWIASMVADVHRILNRGGIFMYPADKRTPDKPGKLRLMYEANPMAFIVEQAGGAATNG
EKRILDIQPKSLHERVAVFLGSKNEVDRVTRYHLETKK