Protein Info for BPHYT_RS15150 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 317 to 342 (26 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 439 to 457 (19 residues), see Phobius details amino acids 662 to 679 (18 residues), see Phobius details amino acids 687 to 707 (21 residues), see Phobius details amino acids 713 to 733 (21 residues), see Phobius details amino acids 745 to 767 (23 residues), see Phobius details amino acids 776 to 795 (20 residues), see Phobius details PF03176: MMPL" amino acids 190 to 433 (244 residues), 31.4 bits, see alignment E=5.2e-12 amino acids 662 to 791 (130 residues), 21.7 bits, see alignment E=4.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3055)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T683 at UniProt or InterPro

Protein Sequence (803 amino acids)

>BPHYT_RS15150 membrane protein (Burkholderia phytofirmans PsJN)
MDMLQQRSAKQAWGMRAAWLLLALAAALYCGWRFAGPSPLQTNLLALLPATEADPVAEKA
VDTLASALGDRTVFLVTSNDDAHAKAAAKQLGASLQKSGAFGSVTAELPPFDLSQIAALY
MPYRFGLLAPADRAALASGTVGTTTLHDALAQRIYSPLRGGLTTPLSDDPFGWLEHWLGG
LPLATSNLELEDNMLVAHQGAATSVLIVATLPGSAYETKTQHAVLASLAQGESTLKQSFP
DVSVARTGAVFYAESARSASEHEVHLIGLASLCGIALLMMWVFRSPRLLLLGFVSTALGI
VCALAVTMLVFGKLHLLTLVFGASLIGEAVDYSIQYFVVYLGAQRDWDARRGARAVRPAL
SVALATSLLGYAILTWVPFPALKQIACFAIAGITTAFASVLWLLPALLTRAPKRSPKRVF
AGAARVLTVWHRTIGGRRAWFVAALLLLLAIPGWLRLTSDDDIHLLIQRDPALVAQEDKV
RAAVGVDNSAQFFVVRGETPEVVLQRAEALGTKLDALNGTADKVGSYQSVAQFVPSAKQQ
NEDRALLSQHVFNDRAALRATLLQAGFKDEVADAWLAAYAKPQAPLTIDTWLATPWSQPY
KHLWLGEVDSSTKAYAAVVIPQGVTPQNEPALIAAAQGLSGVVFVDKAASVSKLFGAYRV
DSGWWLGGALALVLVLLMLRYKVRGGIAVTLPVLLAVGVTLAVFGYAHVPLNLFNWLALM
LVLGVGANYAVFLREGCLRADADLGAVWTGVLLSAATTLLSFGMLGMSAMPALESFGATL
ALGIAVSVLLAPIGMPLESRRAA