Protein Info for BPHYT_RS15135 in Burkholderia phytofirmans PsJN

Annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 4 to 194 (191 residues), 162.9 bits, E=9.9e-52
• TIGR01831: putative 3-oxoacyl-(acyl-carrier-protein) reductase
  • amino acids 5 to 241 (237 residues), 428.8 bits, E=2.5e-133
• PF08659: KR
  • amino acids 5 to 159 (155 residues), 66.5 bits, E=4.4e-22
• PF13561: adh_short_C2
  • amino acids 9 to 240 (232 residues), 172 bits, E=2.4e-54

Best Hits

Swiss-Prot: 64% identical to FABG_AGGAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to bpy:Bphyt_3052)

MetaCyc: 41% identical to acetoacetyl-CoA reductase subunit (Zoogloea ramigera)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]; 1.1.1.36 [EC: 1.1.1.36]

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• acetyl-CoA fermentation to butanoate (6/7 steps found)
• polyhydroxybutanoate biosynthesis (3/3 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.36

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.36

Sequence Analysis Tools

See B2T680 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BPHYT_RS15135 3-ketoacyl-ACP reductase (Burkholderia phytofirmans PsJN)
MSRRVLVTGASRGIGRAIAYKLAADGFAVSVHCRTGRSEADAVATGIAAQGGTARVLQFD
VRERAVCREVLEADVAAHGPYYGIVCSAGVTRDAAFPALTEEDWDIVIETGLDSFYNVVH
PLTMPMVRARKGGRIVTIASVSGVMGNRGQVNYSAAKAGLIGASKALAVELASRNITVNC
VAPGLIETGMLDEMPLEQALKTVPMNRVGQPAEVASVVSFLMSDAASYVTRQVIGVNGGM
I