Protein Info for BPHYT_RS15080 in Burkholderia phytofirmans PsJN

Annotation: FAD-binding molybdopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 TIGR02963: xanthine dehydrogenase, small subunit" amino acids 34 to 513 (480 residues), 690.3 bits, see alignment E=5.9e-212 PF01799: Fer2_2" amino acids 114 to 191 (78 residues), 107.1 bits, see alignment E=8.1e-35 PF00941: FAD_binding_5" amino acids 240 to 403 (164 residues), 166.1 bits, see alignment E=1.3e-52 PF03450: CO_deh_flav_C" amino acids 411 to 512 (102 residues), 117.1 bits, see alignment E=7.2e-38

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 100% identity to bpy:Bphyt_3041)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T669 at UniProt or InterPro

Protein Sequence (543 amino acids)

>BPHYT_RS15080 FAD-binding molybdopterin dehydrogenase (Burkholderia phytofirmans PsJN)
MAIYVREAGFGATPCVTRARSAVSSGFAMTTQTIRFYHQGAVREVAGVPASRTVLQHLRE
DLHCTGTKEGCAEGDCGACTVVVGELDAHGGLALKAVNACIQFLPTLDGKALFTVEDLRA
ADGALHPVQQAMVDCHGSQCGFCTPGFVMSMWALYENQPAAAGLPTRDEINAALSGNLCR
CTGYRPIVDASQKMFDYPQYPRVTLDRKAVADQLRELQRRDSFEYRAPDTRGAAFGSPAF
HAPVSLDAFAKLRADHPQARLLAGSTDVGLWVTKQFRDLGDILYIGNVAELKTIERDAQT
LTIGAAVTLEDAYAALAVDYPELAELWTRFASLPIRNAGTLGGNVANGSPIGDSMPALLA
LGAEVVLRHGPKTRSLPLDAFCLGYQKTALAAGEFVAALRVPRPAGNLRFRTYKVSKRYD
QDISAVCAAFALHLGEHGVIEQARIAFGGMAATPKRAAQTEAVLNGASWDESTARQAMNA
LVADYQPLTDMRASSAYRLKVARNLLWRFHLETRDDAPLALFDVNAFAFEAGAPDAAVAK
EPS