Protein Info for BPHYT_RS15020 in Burkholderia phytofirmans PsJN

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 11 to 68 (58 residues), 29 bits, 1.2e-09
  • amino acids 73 to 137 (65 residues), 50.7 bits, E=2e-16
  • amino acids 115 to 170 (56 residues), 38.6 bits, 1.2e-12
  • amino acids 177 to 239 (63 residues), 43.2 bits, E=4.5e-14
  • amino acids 244 to 289 (46 residues), 23.7 bits, 5.8e-08
  • amino acids 292 to 329 (38 residues), 18.1 bits, 3.1e-06
• PF13181: TPR_8
  • amino acids 36 to 68 (33 residues), 15.3 bits, see alignment (E = 1.9e-05)
  • amino acids 71 to 101 (31 residues), 20.1 bits, see alignment (E = 5.5e-07)
  • amino acids 105 to 136 (32 residues), 22.7 bits, see alignment (E = 8e-08)
  • amino acids 137 to 169 (33 residues), 20.2 bits, see alignment (E = 5.1e-07)
  • amino acids 172 to 202 (31 residues), 17.2 bits, see alignment (E = 4.8e-06)
  • amino acids 207 to 237 (31 residues), 20.5 bits, see alignment (E = 4.2e-07)
  • amino acids 241 to 271 (31 residues), 20 bits, see alignment (E = 6.1e-07)
• PF07721: TPR_4
  • amino acids 37 to 60 (24 residues), 12.4 bits, see alignment (E = 0.00022)
  • amino acids 103 to 127 (25 residues), 20.4 bits, see alignment (E = 5.9e-07)
  • amino acids 206 to 226 (21 residues), 10.2 bits, see alignment (E = 0.0012)
  • amino acids 245 to 263 (19 residues), 11.2 bits, see alignment (E = 0.00058)
• PF14559: TPR_19
  • amino acids 47 to 90 (44 residues), 29.2 bits, 1e-09
  • amino acids 81 to 137 (57 residues), 32 bits, 1.3e-10
  • amino acids 183 to 237 (55 residues), 28.3 bits, 1.9e-09
  • amino acids 249 to 316 (68 residues), 25.7 bits, E=1.2e-08
• PF13424: TPR_12
  • amino acids 69 to 133 (65 residues), 31.8 bits, E=1.4e-10
  • amino acids 105 to 167 (63 residues), 39.6 bits, E=5.3e-13
  • amino acids 171 to 235 (65 residues), 34.1 bits, E=2.6e-11
• PF13428: TPR_14
  • amino acids 70 to 111 (42 residues), 24 bits, 4.4e-08
  • amino acids 243 to 280 (38 residues), 24 bits, 4.4e-08
• PF07719: TPR_2
  • amino acids 70 to 101 (32 residues), 23.7 bits, see alignment (E = 3.9e-08)
  • amino acids 104 to 136 (33 residues), 34.1 bits, see alignment (E = 1.7e-11)
  • amino acids 206 to 237 (32 residues), 24.9 bits, see alignment (E = 1.6e-08)
• PF13429: TPR_15
  • amino acids 73 to 232 (160 residues), 26.4 bits, E=4.7e-09
• PF13414: TPR_11
  • amino acids 76 to 117 (42 residues), 44.5 bits, 1.1e-14
  • amino acids 110 to 151 (42 residues), 33.8 bits, 2.3e-11
• PF13174: TPR_6
  • amino acids 105 to 135 (31 residues), 14.5 bits, see alignment (E = 4.8e-05)
• PF13176: TPR_7
  • amino acids 105 to 136 (32 residues), 20 bits, see alignment (E = 5.7e-07)
  • amino acids 207 to 237 (31 residues), 16.7 bits, see alignment (E = 6.4e-06)
• PF00515: TPR_1
  • amino acids 105 to 136 (32 residues), 35.6 bits, see alignment (E = 5.9e-12)
• PF13431: TPR_17
  • amino acids 125 to 158 (34 residues), 25 bits, see alignment (E = 1.6e-08)
• PF13374: TPR_10
  • amino acids 138 to 167 (30 residues), 17.2 bits, see alignment (E = 4.6e-06)
  • amino acids 171 to 199 (29 residues), 14.7 bits, see alignment (E = 2.7e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3028)

Predicted SEED Role

"TPR repeat"

Sequence Analysis Tools

See B2T656 at UniProt or InterPro

Protein Sequence (615 amino acids)

>BPHYT_RS15020 tetratricopeptide repeat protein (Burkholderia phytofirmans PsJN)
MQPVFDRAFAAHRDGRLDDAERGYRATLDGNPAHVDALHLLGVLRHQQGQHAEAAELVRR
AVNLRPEDAALQLNLGNALKALGQIDDAIEQFRNALTLAPSFPMAHYNLGNAYAAAGRHE
DAADAFEKSLRLQPDDASSHNNFGNALHALGRHTEAIAAFRRTIELRPGHAGALNNMGMS
LNALGRAEEAIPCFQTALAAEPRFVAAHFNLANTFDATGRHAEAVASFKAALALQPNLPP
AIFGMGNALAALGRHAEALPYLERAVGLDPQFALAWLSLGTAHQALGAHGPAVRALDQAL
RLRPDLASAHMNRALAWLAQRDFARGLPEYEWRLQTMAQPVIQTLPRWHGEPIAERTLLV
HAEQGFGDTLQFVRFVPLVAQRAARVVLEVQPQLLPLLAPAAQAWRVTLIAQGAPRPAAD
LHCPLLSLPLALGTTFDTIPQRTPYLSVPAAYGRKWRGSLGGQAKRKIGIAWSGRIQQNE
TRSMQLAALDPLFALEGIDWIVLQPELSAEERMALDTHPRAASIHRFDKRIGDFADTAAI
IERLDAVVSIDTSIAHVAGALRKPLWLMLPFAADWRWFAGETGSPWYPGATLVRQPQPGA
WGDVVEAVANALRKG