Protein Info for BPHYT_RS15010 in Burkholderia phytofirmans PsJN

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 79 to 349 (271 residues), 233.9 bits, see alignment E=1.1e-73 PF01545: Cation_efflux" amino acids 83 to 269 (187 residues), 134.4 bits, see alignment E=2.3e-43

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to bpy:Bphyt_3026)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T654 at UniProt or InterPro

Protein Sequence (366 amino acids)

>BPHYT_RS15010 cation transporter (Burkholderia phytofirmans PsJN)
MKKPETPNLVAAHRHDCTSGHADQVGQAQGVHGHSESSHGDSHSHGGHNHNHGGHSHGGH
SHGHAGHHHAHAPVAGHGRAFALAVVLNIAIVIAQAVYGVLAHSTALLADAGHNLSDVLG
LLLAWGASWLATRRPSARYTFGYGSSSILASLVNAGLLLFACGVIVAEAIGRLMNPAPVA
GFAVFVVATLGVVVNGISAWLFMRGQKDDLNIRGAFLHMAADAGISAAVAVSGLVILYTN
WTWLDPIMSLLVVAVVVVGTWGLLRDSVRLALDAVPPGVDLQSIRDYLAGQPGVVDVHDL
HVWALSTTGNALSAHLVMPDGHPGDESLDGIVVILRERFSMQHATLQVDLGTTNHRCAMD
HAPHAH