Protein Info for BPHYT_RS14900 in Burkholderia phytofirmans PsJN

Annotation: prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details amino acids 26 to 26 (1 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 27 to 28 (2 residues), see Phobius details PF03807: F420_oxidored" amino acids 12 to 107 (96 residues), 24.8 bits, see alignment E=5.6e-09 PF02153: PDH_N" amino acids 24 to 185 (162 residues), 107.9 bits, see alignment E=7.2e-35 PF20463: PDH_C" amino acids 191 to 288 (98 residues), 91.6 bits, see alignment E=6.9e-30

Best Hits

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 100% identity to bpy:Bphyt_3004)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T631 at UniProt or InterPro

Protein Sequence (313 amino acids)

>BPHYT_RS14900 prephenate dehydrogenase (Burkholderia phytofirmans PsJN)
MTDVAAFSFNKLVIFGVGLIGGSLARALRERGEADGARKVIGVGRSSASTERALELGVID
GSASLNDDAALSEALKGADFVLLAAPVAQTQPLLERIAPFLDAATIVTDAGSTKSDVVAA
ARAALGARIGQFVPGHPIAGREASGVEAALPDLYVGRNVVLCPLPENAPADVERVAAMWR
ATGALVRDMAPEQHDRVLASVSHLPHVLSFALVEQILNSPDAALKFSFAAGGFRDFTRIA
ASSPEMWRDVCVANRVALLDELDAYTAVLARLRAAIEAADGAALEAVFARSRVARTEWQE
QRAAGVANSDASK