Protein Info for BPHYT_RS14825 in Burkholderia phytofirmans PsJN

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 121 to 138 (18 residues), see Phobius details PF12146: Hydrolase_4" amino acids 47 to 284 (238 residues), 241.4 bits, see alignment E=2.1e-75 PF00561: Abhydrolase_1" amino acids 52 to 174 (123 residues), 47 bits, see alignment E=6.7e-16 PF12697: Abhydrolase_6" amino acids 54 to 288 (235 residues), 60.3 bits, see alignment E=1.1e-19 PF00975: Thioesterase" amino acids 62 to 155 (94 residues), 31.4 bits, see alignment E=5.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2989)

Predicted SEED Role

"Lysophospholipase (EC 3.1.1.5); Monoglyceride lipase (EC 3.1.1.23); putative" (EC 3.1.1.23, EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.23 or 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T619 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BPHYT_RS14825 hydrolase (Burkholderia phytofirmans PsJN)
MDTFQSSNVRSVAGNSGGNTAGEPQRGSVTTADGVDLPLYRWPATPPMRATVALLHGLAE
HAGRYAALAARLNAAGIELVAIDLRGHGYAPGKRSYVKRFDDYLLDAQALLDAAAQSCAP
LFLMGHSMGGAVAALYAIERLDASGRRLNGLILSSPALAPGRDVPRWMLKLSQVISRLYP
SFPAMKIDAALLSRLQPVVNANRNDPLVHHGAIPARTGAELLLAMARIERGRAGLRVPLL
VYHGTADKLTEPEGSREFGQHAGSPDKTLTLHEGSYHETMNDLDRDRVIGALIDWIERRL
VIR