Protein Info for BPHYT_RS14785 in Burkholderia phytofirmans PsJN

Annotation: AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13412: HTH_24" amino acids 11 to 58 (48 residues), 71.1 bits, see alignment E=6.6e-24 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 66.8 bits, see alignment E=1.8e-22 PF01037: AsnC_trans_reg" amino acids 77 to 151 (75 residues), 73.3 bits, see alignment E=1.9e-24

Best Hits

Swiss-Prot: 55% identical to LRP_KLEAE: Leucine-responsive regulatory protein (lrp) from Klebsiella aerogenes

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to bpy:Bphyt_2981)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T611 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BPHYT_RS14785 AsnC family transcriptional regulator (Burkholderia phytofirmans PsJN)
MRTQRQPVRALDKLDRKILRLLQQDGRMAMKDLAEQVGLSVTPCIERVKRMERDGVITGY
YARVNPAELGAALLVFVEITLDHKSGNMFDQFRREVQKIPEVLECHLVSGDFDYLIKARI
GEMADYRKLLGDILLQLPGAVQSKSYVVMEEIKETLMIPVGD