Protein Info for BPHYT_RS14715 in Burkholderia phytofirmans PsJN

Annotation: molybdenum cofactor biosynthesis protein MogA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 2 to 146 (145 residues), 118.8 bits, E=9.6e-39
• PF00994: MoCF_biosynth
  • amino acids 4 to 145 (142 residues), 86.9 bits, E=5.6e-29

Best Hits

Swiss-Prot: 73% identical to MOG_ECOLI: Molybdopterin adenylyltransferase (mog) from Escherichia coli (strain K12)

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 100% identity to bpy:Bphyt_2967)

MetaCyc: 73% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

• molybdenum cofactor biosynthesis (3/3 steps found)
• bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Sequence Analysis Tools

See B2T5Z7 at UniProt or InterPro

Protein Sequence (198 amino acids)

>BPHYT_RS14715 molybdenum cofactor biosynthesis protein MogA (Burkholderia phytofirmans PsJN)
MIGLVSISDRASTGVYEDKGIPALQEWLGAALTSPWQVVTRLIQDDAPTISATLTELVDE
VGCDLVLTTGGTGPSRRDVTPEATLAVATKEMPGFGEQMRQISLNFVPTAILSRQVAVIR
ETAEHAALIVNLPGQPKSIKETLEGLRDAEAGGAVKVPGIFAAVPYCIDLIGGPYVETNA
DVVKAFRPKNAQRAPRPA