Protein Info for BPHYT_RS14605 in Burkholderia phytofirmans PsJN

Annotation: sodium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 274 to 288 (15 residues), see Phobius details PF13593: SBF_like" amino acids 9 to 250 (242 residues), 72.4 bits, see alignment E=4.3e-24 PF01758: SBF" amino acids 36 to 214 (179 residues), 136.8 bits, see alignment E=7.3e-44

Best Hits

Swiss-Prot: 72% identical to PANS_SALTY: Pantothenate precursors transporter PanS (panS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to bpy:Bphyt_2945)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5X5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BPHYT_RS14605 sodium transporter (Burkholderia phytofirmans PsJN)
MLARVTRLFPLWAVLVSIAAYFSPASFAGVAPHVTTLLTIIMLAMGVTLSVADFQRVFTR
PAPVIAGIVLHYLVMPLAAWVIAKALRMPPDLTAGMVLVGSVASGTASNVMIYLARGDVA
LSVTISALSTLVGVFATPLLTRLYVDASIAVDVHGMLMSILQIVALPIVVGLIVNHLFGK
VVRKIEPILPLISMVAIVLIIGAVVGGTQKSIASVGLVVMLGVVLHNGIGLLGGYWGGRL
LGFDEAVCRTLAIEVGMQNSGLAATLGKLYFTPIAALPGALFSVWHNLSGSLLAGYWAGR
PAKSWTHADGGQVLNTERG