Protein Info for BPHYT_RS14340 in Burkholderia phytofirmans PsJN

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 84.4 bits, see alignment E=1.9e-27 PF14532: Sigma54_activ_2" amino acids 145 to 319 (175 residues), 70 bits, see alignment E=7.4e-23 PF00158: Sigma54_activat" amino acids 145 to 314 (170 residues), 170.5 bits, see alignment E=8.2e-54 PF07728: AAA_5" amino acids 168 to 292 (125 residues), 23.5 bits, see alignment E=1.5e-08 PF02954: HTH_8" amino acids 417 to 456 (40 residues), 47 bits, see alignment 4.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2893)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZU9 at UniProt or InterPro

Protein Sequence (460 amino acids)

>BPHYT_RS14340 Fis family transcriptional regulator (Burkholderia phytofirmans PsJN)
MPHALIVEDDPNSLSGLSAILAADGFSVDTATTIAEARAALTRFIPDVVLVDLNLPDGSG
LDLLQHLPAHPPGGALPVIVMTGNATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPR
PYELTEEVQTLRASLRQLGRFGSMLGRSGAIQHVYDTIEHIAPTEAAVLISGETGTGKQI
AARTMHDMSRRRKGPFITFDCRSANSAGVQRSLDSLLFGHERGAFNGAEQREPGLFEQAS
GGTLFIEEIAELPRAQQEALLRALDSQTFMRVGGTNQVVTDFRLIASTRKAPRAAVADGS
LHEDLALRLEAAAVTLPPLRERGEDPALIAQAVVDELNHEGLTRGSAESAKQVAPNFLRE
CLAYEWPGNVRELQDRVRRAYHASGDVLESLRADEAGSANGRDLNGSRVQVTVGTPLADV
EEMLIRATLDAVGGTRHRAASLLGISPKTLYNKLQRMRLN