Protein Info for BPHYT_RS14280 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF09678: Caa3_CtaG" amino acids 28 to 263 (236 residues), 194.8 bits, see alignment E=7.6e-62

Best Hits

KEGG orthology group: K02351, putative membrane protein (inferred from 100% identity to bpy:Bphyt_2884)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZU0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>BPHYT_RS14280 membrane protein (Burkholderia phytofirmans PsJN)
MNLLYWLDPWEFSPTVVIALLVPAILFVRGARKAKVSVARRISFWFGLVALYVALHTRLD
YFFEHEFFMHRAQHLVLHHLGPFFIALSYPGAALRAGIPFSWRQRFVRPALGTPVVRKLL
DVVMHPVVAVTLFVGLIYFWLMSPIHFVAMLDWRLYRVMNWSMVIDGLLFWWLVLDPRPA
PPARLSPGMRVLVVIAAIPPQIILGAFIFFTPHELYPIYSICGRAFTWLSPMRDQQIGGL
LLWIPGSMMSVIGALLALRHWMRLSARGRLRSERRAKAKQSLAPARGQH