Protein Info for BPHYT_RS14220 in Burkholderia phytofirmans PsJN

Annotation: ribonuclease H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF00075: RNase_H" amino acids 7 to 142 (136 residues), 172.1 bits, see alignment E=3.9e-55

Best Hits

Swiss-Prot: 74% identical to RNH_CHRVO: Ribonuclease H (rnhA) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K03469, ribonuclease HI [EC: 3.1.26.4] (inferred from 100% identity to bxe:Bxe_A1251)

MetaCyc: 63% identical to ribonuclease HI (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HI (EC 3.1.26.4)" in subsystem Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZS9 at UniProt or InterPro

Protein Sequence (148 amino acids)

>BPHYT_RS14220 ribonuclease H (Burkholderia phytofirmans PsJN)
MTSDLIDIYTDGACKGNPGPGGWGALLRFGDQEKELFGGEANTTNNRMELMGVIAALEAL
KRPCKAVVHTDSQYVQKGISEWIHGWKKKGWITAAKQPVKNADLWKRLDALVAQHEIEWR
WVRGHNGHPENERADQLANRGVASLAQL