Protein Info for BPHYT_RS14210 in Burkholderia phytofirmans PsJN

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 7 to 262 (256 residues), 330.4 bits, see alignment E=3.3e-103 PF00753: Lactamase_B" amino acids 15 to 174 (160 residues), 62.4 bits, see alignment E=8.6e-21 PF12706: Lactamase_B_2" amino acids 43 to 90 (48 residues), 27.9 bits, see alignment 2.6e-10 PF16123: HAGH_C" amino acids 175 to 262 (88 residues), 91.1 bits, see alignment E=7.1e-30

Best Hits

Swiss-Prot: 63% identical to GLO2_CUPTR: Hydroxyacylglutathione hydrolase (gloB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 100% identity to bpy:Bphyt_2871)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZS7 at UniProt or InterPro

Protein Sequence (263 amino acids)

>BPHYT_RS14210 hydroxyacylglutathione hydrolase (Burkholderia phytofirmans PsJN)
MNALEYVPVPAFDDNYIWVVSDGRHAAVVDPGEAAPVKAYLAKRGWRLSAILLTHHHQDH
VGGVADLLNGQAVPVYGPAGEAIEHLTHRLKNGDHVSIAAPALKLSVLDVPGHTSGHIAY
FQAADPQGTPHVFCGDTLFACGCGRLFEGTPKQMLASLDSLAALPGATEVHCAHEYTLSN
IRFALACEPGNAELQAWRDKASELRARDVPTLPTTIAHERAVNPFLRAGDPAVQASLREQ
LHEAVPDRLTAFTLMREWKNRFR