Protein Info for BPHYT_RS14120 in Burkholderia phytofirmans PsJN

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 2 to 229 (228 residues), 350.4 bits, see alignment E=1.7e-109 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 88.1 bits, see alignment E=4.7e-29 PF00486: Trans_reg_C" amino acids 157 to 229 (73 residues), 95.1 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 58% identical to PHOB_ECO57: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli O157:H7

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 96% identity to bgd:bgla_1g13510)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZQ9 at UniProt or InterPro

Protein Sequence (233 amino acids)

>BPHYT_RS14120 chemotaxis protein CheY (Burkholderia phytofirmans PsJN)
MPSSILVIEDEPAISELISVNLQHAGHCPIRAYNAEQAQNLISDVLPDLVLLDWMLPGKS
GIAFARDLRNNERTKHIPIIMLTARGDEQDKVLGLEIGADDYVTKPFSPKELMARIKAVL
RRRAPQLTEDVVAINGLKLDPATHRVAAHAEGSEIKLDLGPTEFRLLHFFMTHPERVHSR
TQLLDQVWGDHVFVEERTVDVHIKRLRAALKPAGCDAMIETVRGSGYRLAKSA