Protein Info for BPHYT_RS13945 in Burkholderia phytofirmans PsJN

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 229 to 244 (16 residues), see Phobius details amino acids 261 to 292 (32 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 310 (266 residues), 88.5 bits, see alignment E=2.2e-29

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_2817)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SZM3 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BPHYT_RS13945 branched-chain amino acid ABC transporter permease (Burkholderia phytofirmans PsJN)
MREAGGSSAKSKAEPHARWRVLAPWLALILFLAVPPFVWPQSWLLAYLAQTATMIVFALS
YNLLLGETGLLSFGHAAYSGLGALMAAQVFNRIGVPLALLPLVGGIGGALCGVLFGFIST
RRAGTAFAMITLGLGELVAAAAWTLPDWFGGEAGVAIDRASGVPLGSWSFGPAREAYALI
AVWCLLACAMMFALSRTPFMRLANAVRDNPVRAAAIGCCPRRVRYGVVVMSAFFAGIAGT
LALINVELVSTESVGMMRSGAVLIATVIGGTAAFFGPVAGAVVLTFFSVAVASVTRAWLF
YLGLFFIVIVMMSPDGLAGFARRFMARVAAHGWSRCGAAYGWGAVAALLWSVAAVLAVQW
AYAAQFDAGDGAVFSVPGVPSWIIASPVYFGATVFVLAALGGLAAHYARRAQALFAALRS
NVTPTAGASR