Protein Info for BPHYT_RS13850 in Burkholderia phytofirmans PsJN

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13276: HTH_21" amino acids 41 to 92 (52 residues), 53.3 bits, see alignment 5.4e-18 PF00665: rve" amino acids 120 to 215 (96 residues), 89.9 bits, see alignment E=2.4e-29 PF13683: rve_3" amino acids 204 to 270 (67 residues), 47.6 bits, see alignment E=2.1e-16 PF13333: rve_2" amino acids 222 to 275 (54 residues), 33.1 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to bps:BPSS2148)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>BPHYT_RS13850 transposase (Burkholderia phytofirmans PsJN)
MIRSLKKAWPVSLMCRLLKVPRSSYYAFAARPPKPGASPPLLKAVRQIHSESRSSYGSRR
MAQALQQQGYAIGRYRARSLMREAQLAVARRRTHRYRKAEGEALIAPNLLERQFEPGAIN
RVWAGDITYVRTRQGWSYLAIVMDLHSRRIVGWAFALQADTELVIQALQQARQKRRPAAG
LMFHSDQGCQYTSERFVGDLKANGIVQSMSRKGNCWDNAVVERFFRSLKSEWIGEQEYGN
HELARRDIAGYIADFYNYRRIHSAANNLPPVRYETSIY