Protein Info for BPHYT_RS13715 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00571: CBS
  • amino acids 14 to 58 (45 residues), 42.2 bits, E=4.1e-15
  • amino acids 71 to 125 (55 residues), 47.3 bits, E=1e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to bxe:Bxe_A1358)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See B2SZH5 at UniProt or InterPro

Protein Sequence (153 amino acids)

>BPHYT_RS13715 hypothetical protein (Burkholderia phytofirmans PsJN)
MRVSDILKVKGNTLFTVTPDTTLHDAVNAMAEHDIGSLVVMEYGDLVGMLTFREIMLTLS
KNGGSVGTSTIRKVMDDHPLTCTPETDVNEVRRMMLEHHVRYLPVLESRTLMGVISFYDV
AKAVVEEQGFENRMLKAYIRDWPEEQQEQQPAR