Protein Info for BPHYT_RS13575 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF01494: FAD_binding_3" amino acids 34 to 66 (33 residues), 26 bits, see alignment (E = 2.1e-09) PF00890: FAD_binding_2" amino acids 35 to 284 (250 residues), 21.7 bits, see alignment E=4.4e-08 PF01266: DAO" amino acids 35 to 387 (353 residues), 239.2 bits, see alignment E=4e-74 PF13450: NAD_binding_8" amino acids 38 to 77 (40 residues), 26.1 bits, see alignment 3.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2742)

Predicted SEED Role

"FIG00553873: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY54 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BPHYT_RS13575 FAD-dependent oxidoreductase (Burkholderia phytofirmans PsJN)
MVEVEVAKPLPPSLWAATAEPAVVTPPLDNSTVVDVAIVGAGYTGLSTALHLAEQGLRVC
VIDANEPGWGASGRNGGQVIPGLKYDPDELIRRYGPRDGNALVQMAGGAADTVFDLVARH
GIRCDATRAGWIQPTHSHKLLKTLYARAGQWEARGAPVELLDRAQVSKRLGTDAFVGGWV
DRRAGSVQPLSYARGLARAAQAAGAQIHGGTRAAGIERGANGWRIRTAHGPVIESKQVLL
ATNGYTDGLWPRLAQSVIAANSFIVATKPLADDVGATILAGGEVASDSRRLLLYFRKDAD
GRLLMGGRGPFREPRNAADWAHLERAAQLMFPQLRGTEYEFRWAGRIAITRNFLPHVHMP
AKGMTIALGYNGRGIAMATTLGKHLAAYLGGAAKGLPLPPTPIEPVPLHALQRFYISAGV
AWYALLDALS