Protein Info for BPHYT_RS13505 in Burkholderia phytofirmans PsJN

Annotation: 2,4-dienoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00106: adh_short" amino acids 27 to 222 (196 residues), 143.1 bits, see alignment E=1.2e-45 PF08659: KR" amino acids 29 to 146 (118 residues), 47.3 bits, see alignment E=3.5e-16 PF13561: adh_short_C2" amino acids 33 to 271 (239 residues), 178.2 bits, see alignment E=3.2e-56

Best Hits

Swiss-Prot: 42% identical to PECR_RAT: Peroxisomal trans-2-enoyl-CoA reductase (Pecr) from Rattus norvegicus

KEGG orthology group: K13774, citronellol/citronellal dehydrogenase (inferred from 100% identity to bpy:Bphyt_2728)

Predicted SEED Role

"Citronellol and citronellal dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY43 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BPHYT_RS13505 2,4-dienoyl-CoA reductase (Burkholderia phytofirmans PsJN)
MPAASSSSSPLSSGYRSVFRAGLFTGKVVIVTGAGSGLGRCTAHELASLGATLALVGRSE
DKLKAVQAELAADHPSSAIGHKIYSCDIRNEQQVRETIASIITDLGHVDGLFNCAGGQFP
ARLENISLNGWDAVVRNNLHGTFLMSRECYTQWMQHHGGAIVNMLADIWGGMPGMGHSGA
ARAGVWNFTETAACEWGHAGVRVNAVAPGWIASAGMDSYNEEYQALLRTLKHKVPLQRFG
TESELASAAVFLLSEASAFINGTVIRVDGGVPNARHSWPLAEAQRTIEYNGFPRYQPPTG
LQEQTR