Protein Info for BPHYT_RS13410 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF01494: FAD_binding_3" amino acids 14 to 49 (36 residues), 27.5 bits, see alignment 1.2e-09 TIGR04046: flavin-dependent oxidoreductase, MSMEG_0569 family" amino acids 14 to 413 (400 residues), 691.6 bits, see alignment E=1.6e-212 PF07992: Pyr_redox_2" amino acids 14 to 211 (198 residues), 39.6 bits, see alignment E=2.7e-13 PF13738: Pyr_redox_3" amino acids 17 to 207 (191 residues), 81.3 bits, see alignment E=4.7e-26 PF00743: FMO-like" amino acids 71 to 203 (133 residues), 23.7 bits, see alignment E=9.4e-09 PF13434: Lys_Orn_oxgnase" amino acids 89 to 199 (111 residues), 35.3 bits, see alignment E=4.5e-12

Best Hits

KEGG orthology group: K07222, putative flavoprotein involved in K+ transport (inferred from 100% identity to bpy:Bphyt_2709)

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY25 at UniProt or InterPro

Protein Sequence (429 amino acids)

>BPHYT_RS13410 FAD-dependent oxidoreductase (Burkholderia phytofirmans PsJN)
MSNPAHHARAEGHYSVLVIGGGQAGLSVSYYLKEAGIDHLVVEKNTVTHTWREQRWDAFC
LVTPNWQCALPGYPYRGNDPHGFMKKDEIVAYLDGFIAHVDAPLMERTEVKRVKQRDDGV
YAITTTQGDFSADQVVVASGGYHTPIVPRLAERLPARIVQLQSSAYRNPQALPDGAVMVV
GTGQSGAQIAEDLHLAGRKVVLAVGEAPRCARFYRGRDVVDWLADMQYYDMPVEKHPLRE
GVRDNTNHYVTGRDGGRDIDLRKFAAEGMELYGRLDDLRDGQFHFSPTLAANLDAADETY
NRINVSIDNFIEKRGIDAPAGGAYEPVWRPAQERTTLDLEASGIAAIIWCIGFTPDFSWL
DAPVFNGRGYPAHTRGITPIDGLYFVGLPWLHTWGSGRFSGVARDAEFIVQAIREKARER
ASLSSAVAA