Protein Info for BPHYT_RS13385 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF03841: SelA" amino acids 104 to 266 (163 residues), 46.2 bits, see alignment E=5e-16 PF00266: Aminotran_5" amino acids 111 to 240 (130 residues), 31.5 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 58% identical to Y3804_RHILO: Uncharacterized protein mlr3804 (mlr3804) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to bpy:Bphyt_2704)

Predicted SEED Role

"D-Glucosaminate-6-phosphate ammonia-lyase (EC 4.3.1.-)" (EC 4.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.9.1.1

Use Curated BLAST to search for 2.9.1.1 or 4.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SY20 at UniProt or InterPro

Protein Sequence (402 amino acids)

>BPHYT_RS13385 hypothetical protein (Burkholderia phytofirmans PsJN)
MDIRSRFGLRPVINASGTMTSLGASSVSAPVIDTVAQMLPQFVEIDDLQRKASAAISAAC
GSEAGYVTASCSAAITLAIAATMTGDDHGLIERLPDTSSLPGLRNEVVIQTGHLVNYGAP
VDQAIRLSGARVVPVGAATEAHGYQLNTAITERTAAALYVVSHHTVQFGMIPLEEFIAIA
RAKGVPVIVDAASEYDLKRFIAAGADLVLYSAHKFLGGLTAGIVAGKKALVRAAYFQNGG
IGRGMKVGKEGIVGAIAALEQWQQRDHVAIRARERGYLTLWRETLNRCDGVWAEIDADPT
GNPLDRLKLHIDPKQARITAWDLADALAHPSAGEAPVIVRDHEAELHFFFIDPCNLHPGE
EQIVLARLTAELERARLSPEPIVTPFYQRDARRIAARRNWPD